PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02705.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 240aa    MW: 27943.8 Da    PI: 8.6835
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02705.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171057148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+WT++Ed++l++ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Zmw_sc02705.1.g00090.1.sm.mkhc 10 KGPWTEQEDLQLLCTVRLFGERRWDFIAKVTGLNRTGKSCRLRWVNYL 57
                                    79********************************************97 PP

2Myb_DNA-binding55.81e-1763108148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     rgr+T+ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Zmw_sc02705.1.g00090.1.sm.mkhc  63 RGRMTPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.047557IPR017930Myb domain
SuperFamilySSF466891.76E-299104IPR009057Homeodomain-like
SMARTSM007172.3E-15959IPR001005SANT/Myb domain
PfamPF002491.5E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-201164IPR009057Homeodomain-like
CDDcd001674.15E-111257No hitNo description
PROSITE profilePS5129425.99458112IPR017930Myb domain
SMARTSM007171.1E-1662110IPR001005SANT/Myb domain
PfamPF002492.1E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2465111IPR009057Homeodomain-like
CDDcd001671.42E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MVTVREEARK GPWTEQEDLQ LLCTVRLFGE RRWDFIAKVT GLNRTGKSCR LRWVNYLHPG  60
LKRGRMTPHE ERLILELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKRNMS  120
PSSSSSSLTY QSGYPDKPPI IGTEGQELHG GNGCITSILK GDMEWYPMDE LWMEMEAPKV  180
TDFEGEMLQA HACSRSLPEL LPPSAAWDYY YPEPACWKMD PEIKMATQFG YNEGGAGPYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-2871121105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-27711255159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-27711255159MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-28101124105C-Myb DNA-Binding Domain
1msf_C5e-28101124105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664593.11e-129PREDICTED: uncharacterized protein LOC100194394 isoform X3
SwissprotQ4JL761e-113MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLC4J8Y91e-128C4J8Y9_MAIZE; MYB transcription factor
STRINGSb08g018580.11e-128(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169